PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00004.1.g07450.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 201aa    MW: 22719.1 Da    PI: 10.5221
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00004.1.g07450.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like894.3e-281969252
                       G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52
                                  pr+rWt+eLH++F++a+e LGG++kAtPk il++m+ +gLt++hvkSHLQk
  Zjn_sc00004.1.g07450.1.sm.mk 19 PRMRWTTELHRSFLQAIECLGGQDKATPKLILRFMGAEGLTISHVKSHLQK 69
                                  9*************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-261569IPR009057Homeodomain-like
SuperFamilySSF466891.38E-151671IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-221969IPR006447Myb domain, plants
PfamPF002491.8E-72069IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MGSGCRNGAV RRYNRSKEPR MRWTTELHRS FLQAIECLGG QDKATPKLIL RFMGAEGLTI  60
SHVKSHLQKR EVWTVWRRKK RAEMGTEASY KGMQGSQGIS EMRTAANQYY CMHDYMQAMA  120
MEGRIKQEGL RWQRDAAAAA AADVVSSLQT VGCLVQESGS FKVQALHFHG AGGSKLRPRR  180
GLLAERKQLY HLGFADKEEL Q
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6629541e-56AL662954.2 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0005N02, complete sequence.
GenBankAP0149601e-56AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006652650.13e-61PREDICTED: uncharacterized protein LOC102700890
TrEMBLJ3M0G94e-61J3M0G9_ORYBR; Uncharacterized protein
STRINGOB04G28940.11e-60(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29663583
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.12e-25G2-like family protein